PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA007333-PA
Common NameOsI_05477
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 265aa    MW: 29720.6 Da    PI: 7.4106
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA007333-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.41.6e-275099251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      rie+ + rqvtfskRr g+lKKA+ELSvLCdaeva+i+fs++g+ly ++s
  BGIOSGA007333-PA 50 RIEDPTSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPRGRLYQFAS 99
                      8***********************************************86 PP

2K-box74.53e-25118213499
             K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                       ss  + ee+  ++++ e++ L k+ie ++  + +llGe+L+s+s++eLq+Le qLeksl ++R+kK+++l++qi el++ke +l +en+ Lr 
  BGIOSGA007333-PA 118 SSAHEGEESCVQKWRSEATTLGKKIEAIEGYKSKLLGEGLGSCSVQELQELEVQLEKSLCSVRQKKQKMLMDQILELREKEMNLLKENMVLRD 210
                       44444788899*********************************************************************************9 PP

             K-box  97 kle 99 
                       + +
  BGIOSGA007333-PA 211 QCK 213
                       876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd002652.84E-3432118No hitNo description
SMARTSM004322.8E-3541100IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.63241101IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-284363IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-2943119IPR002100Transcription factor, MADS-box
PROSITE patternPS0035004397IPR002100Transcription factor, MADS-box
PfamPF003192.5E-265097IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-286378IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-287899IPR002100Transcription factor, MADS-box
PfamPF014864.0E-25125212IPR002487Transcription factor, K-box
PROSITE profilePS5129713.79128218IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MAAAAAGMGG GGGVQQQETT TTVVQVAAEA SRKKVEVRSA GRRGRREMRR IEDPTSRQVT  60
FSKRRSGLLK KAFELSVLCD AEVALIVFSP RGRLYQFASA SSDLQRTIDR YLNHTKNSSA  120
HEGEESCVQK WRSEATTLGK KIEAIEGYKS KLLGEGLGSC SVQELQELEV QLEKSLCSVR  180
QKKQKMLMDQ ILELREKEMN LLKENMVLRD QCKALSSPWS TSVGELKNKQ ADDDVHRHED  240
YSGGGVRDDD DRRMMEDVET DLIYD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-1843123378Myocyte-specific enhancer factor 2B
1tqe_Q1e-1843123378Myocyte-specific enhancer factor 2B
1tqe_R1e-1843123378Myocyte-specific enhancer factor 2B
1tqe_S1e-1843123378Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.751391e-108root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0040491e-164AP004049.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1212_C06.
GenBankAP0067201e-164AP006720.1 Oryza sativa Japonica Group genomic DNA, chromosome 2, clone:OJA1212_C06.
GenBankAP0149581e-164AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625202.11e-162PREDICTED: MADS-box protein SOC1-like isoform X1
SwissprotQ9XJ602e-68MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLB8AGW10.0B8AGW1_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA007333-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-48AGAMOUS-like 20